Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Csa3G485850_circ_g.1 |
| ID in PlantcircBase | csa_circ_001802 |
| Alias | Chr3:21139477_21139630 |
| Organism | Cucumis sativus |
| Position | chrChr3: 21139477-21139630 JBrowse» |
| Reference genome | Cucumis sativus v1.5 |
| Type | e-circRNA |
| Identification method | Find_circ |
| Parent gene | Csa3G485850 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Csa3G485850.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.138061742 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21139614-21139490(+) |
| Potential amino acid sequence |
MAAITESGRTAEAEAEFEKLLGGADVKYAYAELSKSDKGEDSGAVKLSELLHGRHHREWKNC* |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | He et al., 2020 |