Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0189600_circ_g.1 |
| ID in PlantcircBase | osa_circ_006375 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 6212891-6213463 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0189600 |
| Parent gene annotation |
Pyridoxal phosphate-dependent transferase, major region, subdoma in 1 domain containing protein. (Os10t0189600-01);Pyridoxal phos phate-dependent transferase, major region, subdomain 1 domain co ntaining protein. (Os10t0189600-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os10t0189600-02:3 Os10t0189600-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.170439645 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6213411-6213408(-) |
| Potential amino acid sequence |
MMEMVLPVANATAAALARVSAVFNAPLARAVVFGIHIDGHLVVEGLLIAAILFQLSRKSYKPPK KPLTEREVDELCDDWQPEPLCPPIKEGARIDTPTLERFRTVLNLQSWDQEENYSQ*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |