Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT3G59090_circ_g.6 |
| ID in PlantcircBase | ath_circ_028229 |
| Alias | At_ciR5809 |
| Organism | Arabidpsis thaliana |
| Position | chr3: 21841064-21841332 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | AT3G59090 |
| Parent gene annotation |
AT3g59090/F17J16_140 |
| Parent gene strand | + |
| Alternative splicing | AT3G59090_circ_g.1 AT3G59090_circ_g.2 AT3G59090_circ_g.3 AT3G59090_circ_g.4 AT3G59090_circ_g.5 |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT3G59090.2:2 AT3G59090.3:2 AT3G59090.4:2 AT3G59090.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.133210409 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
21841324-21841329(+) |
| Potential amino acid sequence |
MRKVYVDIFAAIILITGGGICFYGLRLLFNLRKVRSEQVSSEMRKVYVDIFAAIILITGGGICF YGLRLLFNLRKVRSEQVSSEMRKVYVDIFAAIILITGGGICFYGLRLLFNLRKVRSEQVSSEMR K(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |