Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G59090_circ_g.6 |
ID in PlantcircBase | ath_circ_028229 |
Alias | At_ciR5809 |
Organism | Arabidpsis thaliana |
Position | chr3: 21841064-21841332 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | AT3G59090 |
Parent gene annotation |
AT3g59090/F17J16_140 |
Parent gene strand | + |
Alternative splicing | AT3G59090_circ_g.1 AT3G59090_circ_g.2 AT3G59090_circ_g.3 AT3G59090_circ_g.4 AT3G59090_circ_g.5 |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT3G59090.2:2 AT3G59090.3:2 AT3G59090.4:2 AT3G59090.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.133210409 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21841324-21841329(+) |
Potential amino acid sequence |
MRKVYVDIFAAIILITGGGICFYGLRLLFNLRKVRSEQVSSEMRKVYVDIFAAIILITGGGICF YGLRLLFNLRKVRSEQVSSEMRKVYVDIFAAIILITGGGICFYGLRLLFNLRKVRSEQVSSEMR K(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |