Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0848475_circ_g.3 |
| ID in PlantcircBase | osa_circ_004831 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 36447492-36447871 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ui-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os01g0848475 |
| Parent gene annotation |
Hypothetical protein. (Os01t0848475-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 7 |
| Tissues | root, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0848400-01:1 Os01t0848475-00:1 Os01t0848400-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_002540* osi_circ_010930 |
| PMCS | 0.337435526 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
36447828-36447828(-) |
| Potential amino acid sequence |
MASFETVAGFSNAAPFAALALRAMAKHFKCLKSMILNQLRNTSNKVAVKDGLNKEIAVFGLAGG SSGGAGLQRANSASAFGQPHNIWRPQRGLPERAVSVLRAWLFEHFLHPFARGTGSTTSRFRL*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |