Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0848475_circ_g.3 |
ID in PlantcircBase | osa_circ_004831 |
Alias | NA |
Organism | Oryza sativa |
Position | chr1: 36447492-36447871 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ui-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os01g0848475 |
Parent gene annotation |
Hypothetical protein. (Os01t0848475-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 7 |
Tissues | root, pistil |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0848400-01:1 Os01t0848475-00:1 Os01t0848400-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_002540* osi_circ_010930 |
PMCS | 0.337435526 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
36447828-36447828(-) |
Potential amino acid sequence |
MASFETVAGFSNAAPFAALALRAMAKHFKCLKSMILNQLRNTSNKVAVKDGLNKEIAVFGLAGG SSGGAGLQRANSASAFGQPHNIWRPQRGLPERAVSVLRAWLFEHFLHPFARGTGSTTSRFRL*( -) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |