Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0280400_circ_g.3 |
| ID in PlantcircBase | osa_circ_014271 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 10375009-10375987 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os02g0280400 |
| Parent gene annotation |
Similar to casein kinase I isoform delta-like. (Os02t0280400-01) ;Similar to Dual specificity kinase 1. (Os02t0280400-02);Hypothe tical gene. (Os02t0280400-03) |
| Parent gene strand | + |
| Alternative splicing | Os02g0280400_circ_g.1 Os02g0280400_circ_g.2 Os02g0280400_circ_g.4 Os02g0280400_circ_g.5 Os02g0280400_circ_g.6 |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0280400-02:5 Os02t0280400-01:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_011550 |
| PMCS | 0.154723468 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
10375929-10375056(+) 10375091-10375963(-) 10375248-10375896(-) |
| Potential amino acid sequence |
MQFKSTAENSRSSNRHTDKLSSLAGFKSCHKEAEIR*(+) MGVASFFSLILSYFCFFVAAFKPCQGRQFVSMPIT*(-) MSMNGNNENKKQIQQDGIYIKPRWVLRAFSHLFYRISASLWQLLNPAKEDNLSVCRLLERLFSA VDLNCILIAGRCSDSS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |