Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0158700_circ_g.2 |
| ID in PlantcircBase | osa_circ_018039 |
| Alias | Os_ciR8873 |
| Organism | Oryza sativa |
| Position | chr3: 3153344-3153707 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circseq_cup, find_circ |
| Parent gene | Os03g0158700 |
| Parent gene annotation |
Similar to PA domain containing protein, expressed. (Os03t015870 0-01);Similar to P69C protein. (Os03t0158700-02) |
| Parent gene strand | - |
| Alternative splicing | Os03g0158700_circ_g.1 |
| Support reads | 2/17/18 |
| Tissues | root/root/root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0158700-01:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_013701 |
| PMCS | 0.169422665 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3153556-3153685(+) |
| Potential amino acid sequence |
MVSAKIRPAPPAAYTASAATPLDAVVVEKHRTILPDAAARLPLVSWSNEQDLKDVRGDGAGAPG GEVGDGRRRRLADERRARGEARGRRAAAAADVVEDPGALAEVDVDGGEEVVLRRPAGDGLGEDQ AGAAGGVHRQRRDAAGRRRGGEAQNDPAGRRRPAPVG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |