Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os03g0158700_circ_g.2 |
ID in PlantcircBase | osa_circ_018039 |
Alias | Os_ciR8873 |
Organism | Oryza sativa |
Position | chr3: 3153344-3153707 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circseq_cup, find_circ |
Parent gene | Os03g0158700 |
Parent gene annotation |
Similar to PA domain containing protein, expressed. (Os03t015870 0-01);Similar to P69C protein. (Os03t0158700-02) |
Parent gene strand | - |
Alternative splicing | Os03g0158700_circ_g.1 |
Support reads | 2/17/18 |
Tissues | root/root/root, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os03t0158700-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_013701 |
PMCS | 0.169422665 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
3153556-3153685(+) |
Potential amino acid sequence |
MVSAKIRPAPPAAYTASAATPLDAVVVEKHRTILPDAAARLPLVSWSNEQDLKDVRGDGAGAPG GEVGDGRRRRLADERRARGEARGRRAAAAADVVEDPGALAEVDVDGGEEVVLRRPAGDGLGEDQ AGAAGGVHRQRRDAAGRRRGGEAQNDPAGRRRPAPVG*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Ye et al., 2016;Chu et al., 2017 |