Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d050219_circ_g.2 |
ID in PlantcircBase | zma_circ_008057 |
Alias | zma_circ_0001820 |
Organism | Zea mays |
Position | chr4: 74336676-74336973 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d050219 |
Parent gene annotation |
Phosphatidylinositol 3-kinase VPS34 |
Parent gene strand | + |
Alternative splicing | Zm00001d050219_circ_g.1 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d050219_T002:2 Zm00001d050219_T003:2 Zm00001d050219_T016:1 Zm00001d050219_T004:2 Zm00001d050219_T006:2 Zm00001d050219_T009:2 Zm00001d050219_T007:2 Zm00001d050219_T008:2 Zm00001d050219_T010:2 Zm00001d050219_T001:2 Zm00001d050219_T013:2 Zm00001d050219_T015:2 Zm00001d050219_T011:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.138563705 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
74336682-74336971(-) 74336920-74336971(-) |
Potential amino acid sequence |
MFVNASCERDVRSLYLVLNVMSSFQQYFGPEGSNLVFTGNPNWIPSMYSLHSTKSSGTFWSVNK ICS*(-) MSSFQQYFGPEGSNLVFTGNPNWIPSMYSLHSTKSSGTFWSVNKICS*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |