Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G23020_circ_g.2 |
ID in PlantcircBase | ath_circ_003986 |
Alias | At_ciR5784 |
Organism | Arabidpsis thaliana |
Position | chr1: 8153180-8153347 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | find_circ, CIRI-full |
Parent gene | AT1G23020 |
Parent gene annotation |
Ferric reduction oxidase 3, mitochondrial |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G23020.5:1 AT1G23020.1:1 AT1G23020.6:1 AT1G23020.3:1 AT1G23020.7:1 AT1G23020.4:1 AT1G23020.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.278274205 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8153301-8153182(-) |
Potential amino acid sequence |
MVILMGTVVIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGETNKKVIKNVIKLLTMVILMGTV VIWIMMPTSTYKKIWLKSMRAKLGKSIYFGKPGETNKKVIKNVIKLLTMVILMGTVVIWIMMPT STYKKIWLKSMRAKLGKSIYFGKPGETNKKVIKNVIKLLTMVILMGTVVIWIMMPTSTYKKIWL KSMRAKLGKSIYFGKP(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |