Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0148600_circ_g.1 |
ID in PlantcircBase | osa_circ_010487 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 2392764-2392978 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0148600 |
Parent gene annotation |
Conserved hypothetical protein. (Os12t0148600-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0148600-01:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.211085271 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2392870-2392869(+) 2392913-2392765(+) |
Potential amino acid sequence |
MNSLREECVTPNPKNVDSSSKISSQQGHAKLAAGSSRMITQIRRLRTMRMFSLRVLWKLTHVLL VNFNISRR*(+) MLTAHQKYHRNKDMPNWQQVLLE*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |