Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0165400_circ_g.2 |
| ID in PlantcircBase | osa_circ_018090 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 3527120-3527454 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | PcircRNA_finder |
| Parent gene | Os03g0165400 |
| Parent gene annotation |
Similar to Relative to SR12 protein (Fragment). (Os03t0165400-01 );Similar to Beta-galactosidase. (Os03t0165400-02) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0165400-02:2 Os03t0165400-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.163183657 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
3527363-3527191(+) 3527439-3527219(+) |
| Potential amino acid sequence |
MKTCSAWPADCTVSDRGVPPCRNFSDGSTSTRQSTSNTQQCNFVCTSTKVSIATI*(+) MGLPPHGSPQATLNSATLFVPARRLALPLYEIFRSSLVP*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |