Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0254900_circ_g.2 |
ID in PlantcircBase | osa_circ_001154 |
Alias | Os_ciR2777 |
Organism | Oryza sativa |
Position | chr1: 8476028-8478377 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, find_circ |
Parent gene | Os01g0254900 |
Parent gene annotation |
Similar to Syntaxin 22 (AtSYP22) (AtVAM3). (Os01t0254900-01) |
Parent gene strand | - |
Alternative splicing | Os01g0254200_circ_ag.1 Os01g0254900_circ_g.1 Os01g0254900_circ_g.3 |
Support reads | 4/1 |
Tissues | root/root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0254900-01:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.123837071 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8478300-8476053(+) 8478335-8476046(+) 8476256-8478323(-) |
Potential amino acid sequence |
MISLASLFKLLRCVLHQLCYVLTCLVSAKSSTSEF*(+) MCPSPVVLCVDVSCVSEEFDF*(+) MIDDIDTHIENAVIATTQAKGQLSKAAKTQKSNSSLTQDTSTHNTTGEGHIGEA*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015;Chu et al., 2017 |