Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0254900_circ_g.2 |
| ID in PlantcircBase | osa_circ_001154 |
| Alias | Os_ciR2777 |
| Organism | Oryza sativa |
| Position | chr1: 8476028-8478377 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os01g0254900 |
| Parent gene annotation |
Similar to Syntaxin 22 (AtSYP22) (AtVAM3). (Os01t0254900-01) |
| Parent gene strand | - |
| Alternative splicing | Os01g0254200_circ_ag.1 Os01g0254900_circ_g.1 Os01g0254900_circ_g.3 |
| Support reads | 4/1 |
| Tissues | root/root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0254900-01:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.123837071 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8478300-8476053(+) 8478335-8476046(+) 8476256-8478323(-) |
| Potential amino acid sequence |
MISLASLFKLLRCVLHQLCYVLTCLVSAKSSTSEF*(+) MCPSPVVLCVDVSCVSEEFDF*(+) MIDDIDTHIENAVIATTQAKGQLSKAAKTQKSNSSLTQDTSTHNTTGEGHIGEA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |