Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0939700_circ_g.1 |
| ID in PlantcircBase | osa_circ_005758 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 41270243-41270861 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os01g0939700 |
| Parent gene annotation |
Similar to Esterase D (EC 3.1.1.1). (Os01t0939700-01);Similar to esterase D. (Os01t0939700-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 9 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0939700-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.299345234 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
41270294-41270257(+) 41270370-41270840(-) |
| Potential amino acid sequence |
MYDYVVKELPKVLSDNFEQLNTSRASIFGHSMGGHGALTIYLKNTDKYKSVSAFSPVVNPINCP WGQKAFSNYLGPAKSDWKEYDATCLIKKCNKISTPILIDQVLDSI*(+) MPVKCSAVQSCHLKLLEAPSQHSHTCANFSTFHLLHSNRIQHLVNQNRS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |