Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d027309_circ_g.2 |
ID in PlantcircBase | zma_circ_006342 |
Alias | zma_circ_0000498 |
Organism | Zea mays |
Position | chr1: 2633574-2634419 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d027309 |
Parent gene annotation |
Phosphoglucan phosphatase DSP4 chloroplastic |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d027309_T003:1 Zm00001d027309_T007:2 Zm00001d027309_T004:2 Zm00001d027309_T005:2 Zm00001d027309_T008:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.049191933 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2633629-2633574(+) 2634411-2634411(-) |
Potential amino acid sequence |
MARMSTPKYSRSESCCKQNTVLTPIFRSLSTSSGL*(+) MLISFGRLVSKLYSACSKIQILNILESTSVPFKIILYNSKILCTAVRKLEST*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |