Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d027309_circ_g.2 |
| ID in PlantcircBase | zma_circ_006342 |
| Alias | zma_circ_0000498 |
| Organism | Zea mays |
| Position | chr1: 2633574-2634419 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | ue-circRNA |
| Identification method | find_circ |
| Parent gene | Zm00001d027309 |
| Parent gene annotation |
Phosphoglucan phosphatase DSP4 chloroplastic |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | NA |
| Tissues | leaf, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d027309_T003:1 Zm00001d027309_T007:2 Zm00001d027309_T004:2 Zm00001d027309_T005:2 Zm00001d027309_T008:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.049191933 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2633629-2633574(+) 2634411-2634411(-) |
| Potential amino acid sequence |
MARMSTPKYSRSESCCKQNTVLTPIFRSLSTSSGL*(+) MLISFGRLVSKLYSACSKIQILNILESTSVPFKIILYNSKILCTAVRKLEST*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ma et al., 2021b |