Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT5G06970_circ_g.11 |
ID in PlantcircBase | ath_circ_036810 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr5: 2161818-2162067 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT5G06970 |
Parent gene annotation |
AT5g06970/MOJ9_14 |
Parent gene strand | - |
Alternative splicing | AT5G06970_circ_g.5 AT5G06970_circ_g.6 AT5G06970_circ_g.7 AT5G06970_circ_g.8 AT5G06970_circ_g.9 AT5G06970_circ_g.10 AT5G06970_circ_g.12 AT5G06970_circ_g.13 AT5G06970_circ_g.14 AT5G06970_circ_g.15 AT5G06970_circ_g.16 AT5G06970_circ_g.17 AT5G06970_circ_g.18 AT5G06970_circ_g.19 |
Support reads | 2 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT5G06970.1:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.148649067 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2162056-2161820(-) |
Potential amino acid sequence |
MEDTVTVAMITWRLLLEESDRAMHSNSSDREQIESYVLSSIKNTFTRGSLVMEDTVTVAMITWR LLLEESDRAMHSNSSDREQIESYVLSSIKNTFTRGSLVMEDTVTVAMITWRLLLEESDRAMHSN SSDREQIESYVLSSIKNTFTRGSLVMEDTVTVAMITWRLLLEESDRAMHSNSSDREQIESYVLS SIKNTFTR(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |