Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os04g0613700_circ_g.4 |
| ID in PlantcircBase | osa_circ_025207 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr4: 31111076-31111397 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os04g0613700 |
| Parent gene annotation |
Similar to UDP-N-acetylglucosamine pyrophosphorylase. (Os04t0613 700-01);Similar to cDNA clone:J013000B13, full insert sequence. (Os04t0613700-02);Non-protein coding transcript. (Os04t0613700-0 3) |
| Parent gene strand | - |
| Alternative splicing | Os04g0613700_circ_g.1 Os04g0613700_circ_g.2 Os04g0613700_circ_g.3 Os04g0613700_circ_g.5 Os04g0613700_circ_g.6 Os04g0613700_circ_g.7 Os04g0613700_circ_g.8 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os04t0613700-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.35780132 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
31111373-31111372(+) 31111364-31111364(-) |
| Potential amino acid sequence |
MNRYGVIWTLYGVSIINLPSAETHGRVPCWKNVTWSASKPKYLRLSKNLRVMSSVKGLVIIYQ* (+) MTSPFTDDITRKFFESRKYFGLEADQVTFFQQGTLPCVSADGRFIMETPYKVQITPYLFIGI*( -) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |