Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Zm00001d048292_circ_g.4 |
| ID in PlantcircBase | zma_circ_010098 |
| Alias | Zm09circ00076, GRMZM2G169365_C1 |
| Organism | Zea mays |
| Position | chr9: 154004620-154005372 JBrowse» |
| Reference genome | AGPv4.38 |
| Type | e-circRNA |
| Identification method | CIRI2 |
| Parent gene | Zm00001d048292 |
| Parent gene annotation |
Omega-amidase chloroplastic |
| Parent gene strand | - |
| Alternative splicing | Zm00001d048292_circ_g.1 Zm00001d048292_circ_g.2 Zm00001d048292_circ_g.3 |
| Support reads | NA |
| Tissues | leaf, endosperm |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Zm00001d048292_T004:2 Zm00001d048292_T003:2 Zm00001d048292_T001:2 Zm00001d048292_T002:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.214182475 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
154005289-154005352(+) 154005284-154005346(-) |
| Potential amino acid sequence |
MKGLHLRQLQCPRRTLESCHLSKGHSISPVSTTVGLCPAVRVFDSLKVIFPGMSMSKRWIFLCL PFSWPSEPKTQHVLYKLLPERSAMDPPTRVICKLRATSDSIENEGAASPPASMSSAYSGKLSFE *(+) MLSEVARSLQITLVGGSIAERSGNNLYNTCCVFGSDGQLKGKHRKIHLFDIDIPGKITFKESKT LTAGQSPTVVDTGDMEWPLLK*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | responsive to drought stress |
| Other Information | |
|---|---|
| References | Han et al., 2020;Zhang et al., 2019 |