Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d048292_circ_g.4 |
ID in PlantcircBase | zma_circ_010098 |
Alias | Zm09circ00076, GRMZM2G169365_C1 |
Organism | Zea mays |
Position | chr9: 154004620-154005372 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2 |
Parent gene | Zm00001d048292 |
Parent gene annotation |
Omega-amidase chloroplastic |
Parent gene strand | - |
Alternative splicing | Zm00001d048292_circ_g.1 Zm00001d048292_circ_g.2 Zm00001d048292_circ_g.3 |
Support reads | NA |
Tissues | leaf, endosperm |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Zm00001d048292_T004:2 Zm00001d048292_T003:2 Zm00001d048292_T001:2 Zm00001d048292_T002:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.214182475 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
154005289-154005352(+) 154005284-154005346(-) |
Potential amino acid sequence |
MKGLHLRQLQCPRRTLESCHLSKGHSISPVSTTVGLCPAVRVFDSLKVIFPGMSMSKRWIFLCL PFSWPSEPKTQHVLYKLLPERSAMDPPTRVICKLRATSDSIENEGAASPPASMSSAYSGKLSFE *(+) MLSEVARSLQITLVGGSIAERSGNNLYNTCCVFGSDGQLKGKHRKIHLFDIDIPGKITFKESKT LTAGQSPTVVDTGDMEWPLLK*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020;Zhang et al., 2019 |