Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os11g0186400_circ_g.2 |
| ID in PlantcircBase | osa_circ_008732 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr11: 4388197-4388762 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os11g0186400 |
| Parent gene annotation |
Similar to DNA polymerase delta catalytic subunit (EC 2.7.7.7). (Os11t0186400-00) |
| Parent gene strand | - |
| Alternative splicing | Os11g0186400_circ_g.1 Os11g0186400_circ_g.3 Os11g0186400_circ_g.4 Os11g0186400_circ_g.5 Os11g0186400_circ_g.6 Os11g0186400_circ_g.7 |
| Support reads | 6 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os11t0186400-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.20026755 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
4388628-4388243(+) 4388707-4388605(+) 4388656-4388745(-) 4388630-4388755(-) |
| Potential amino acid sequence |
MSIVSLQISLFHYLKELRLKQPWCDFHEAALYWHSSESAQRSSKVAFPTVLQYNSASLPLQ*(+ ) MKQLSTGILQNRLKDPQKWRFLQFCSITLLLFPCNESKAFDWNHL*(+) MKFAKKQLTCLGCKAVISGSNQTLCFHCKGREAELYCKTVGNATFEDL*(-) MPRMQSSYKWFQSNALLSLQGKRSRVILQNCRKRHF*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |