Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT2G47830_circ_g.6 |
| ID in PlantcircBase | ath_circ_018933 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr2: 19593296-19593545 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | AT2G47830 |
| Parent gene annotation |
Metal tolerance protein C1 |
| Parent gene strand | - |
| Alternative splicing | AT2G47830_circ_g.1 AT2G47830_circ_g.2 AT2G47830_circ_g.3 AT2G47830_circ_g.4 AT2G47830_circ_g.5 |
| Support reads | 3 |
| Tissues | inflorescences |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT2G47830.1:2 AT2G47830.2:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.242359511 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
19593350-19593298(-) |
| Potential amino acid sequence |
MLLATGSGIAWHALDLLSVLSGVALVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSG IAWHALDLLSVLSGVALVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSGIAWHALDL LSVLSGVALVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSGIAWHALDLLS(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |