Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G47830_circ_g.6 |
ID in PlantcircBase | ath_circ_018933 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 19593296-19593545 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT2G47830 |
Parent gene annotation |
Metal tolerance protein C1 |
Parent gene strand | - |
Alternative splicing | AT2G47830_circ_g.1 AT2G47830_circ_g.2 AT2G47830_circ_g.3 AT2G47830_circ_g.4 AT2G47830_circ_g.5 |
Support reads | 3 |
Tissues | inflorescences |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G47830.1:2 AT2G47830.2:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.242359511 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
19593350-19593298(-) |
Potential amino acid sequence |
MLLATGSGIAWHALDLLSVLSGVALVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSG IAWHALDLLSVLSGVALVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSGIAWHALDL LSVLSGVALVSYRAANVPKDKEHPYGHGKFETLGALGISAMLLATGSGIAWHALDLLS(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |