Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0528000_circ_g.2 |
ID in PlantcircBase | osa_circ_028600 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 26238245-26239347 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os05g0528000 |
Parent gene annotation |
Similar to RbohAOsp (Fragment). (Os05t0528000-01) |
Parent gene strand | - |
Alternative splicing | Os05g0528000_circ_g.1 Os05g0528000_circ_g.3 Os05g0528000_circ_g.4 |
Support reads | 7 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0528000-01:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.201385305 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
26238308-26239280(-) |
Potential amino acid sequence |
MILMADARQNLSFTRSISKIRKLQVIFTRQSDAIKHMLILTPL*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |