Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT3G07180_circ_g.4 |
ID in PlantcircBase | ath_circ_020274 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr3: 2283643-2283726 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | AT3G07180 |
Parent gene annotation |
GPI transamidase component PIG-S-like protein |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 1 |
Tissues | leaf, seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT3G07180.3:1 AT3G07180.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.083333333 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2283727-2283645(-) |
Potential amino acid sequence |
MWGGVIVWNPGNCDKDSESPSRNTISLQMWGGVIVWNPGNCDKDSESPSRNTISLQMWGGVIVW NPGNCDKDSESPSRNTISLQMWGGVIVWNPGNCDKDSESPSRNTISLQ(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |