Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d014055_circ_g.2 |
ID in PlantcircBase | zma_circ_008438 |
Alias | Zm05circ00026, zma_circ_0001699, GRMZM2G066578_C1 |
Organism | Zea mays |
Position | chr5: 30848119-30849113 JBrowse» |
Reference genome | AGPv4.38 |
Type | e-circRNA |
Identification method | CIRI2, find_circ |
Parent gene | Zm00001d014055 |
Parent gene annotation |
Protein ECERIFERUM 1 |
Parent gene strand | + |
Alternative splicing | Zm00001d014055_circ_g.1 |
Support reads | NA |
Tissues | leaf, endosperm, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d014055_T003:3 Zm00001d014055_T002:3 Zm00001d014055_T001:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.242095386 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
30848248-30848175(+) 30848131-30849007(-) |
Potential amino acid sequence |
MNNMGHCNFELVPNWLFKWFPPLKYLMYTPSFHSLHHTQFRTNYSLFMPFYDYIYNTMDKSSDT LYEKSLKGKEETADVVHLTHLTSLHSIYHMRPGFAEYASRPYTAKWYVRMMWPMSWLSMVLTWS YGSSFTVERNVMKKLKMQSWVIPRYSFHYGLSWEKEAINSLVEKAICEADKKGAKVVTLGLLNQ PSSIHLLSSWRMNYCSQSH*(+) MDDGWLRSPRVTTLAPFLSASHIAFSTRLLIASFSQLNP*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | responsive to drought stress |
Other Information | |
---|---|
References | Han et al., 2020; Ma et al., 2021b;Zhang et al., 2019 |