Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G245400_circ_g.1 |
| ID in PlantcircBase | gra_circ_000539 |
| Alias | Chr05:62564935|62565266 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 62564935-62565266 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G245400 |
| Parent gene annotation | NA |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2/24 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Gorai.005G245400.3:2 Gorai.005G245400.2:2 Gorai.005G245400.6:2 Gorai.005G245400.5:2 Gorai.005G245400.4:2 Gorai.005G245400.1:2 Gorai.005G245400.7:2 Gorai.005G245400.8:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | gar_circ_000660* |
| PMCS | 0.783413805 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
62565091-62565254(-) 62565085-62564972(+) 62565089-62564994(+) |
| Potential amino acid sequence |
MHADYTGQGFDQLLDVIDKIKNNPNDRRIILSAWNPSDLKLMALPPCHMFAQYRVD*(-) MHVSIPGTKMSPLEPIHRSQVTLLPISQPDTEQTCGKVEVPSV*(+) MSVYLAPKCLHWNPYTGPKSPSSLSVNPILSKHVARWKCHQFEIRRIPG*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |