Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os03g0129200_circ_g.2 |
| ID in PlantcircBase | osa_circ_017754 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr3: 1654921-1655553 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | u-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os03g0129200 |
| Parent gene annotation |
Similar to predicted protein. (Os03t0129200-00) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os03t0129200-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.154296985 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1654929-1655447(+) 1654935-1655488(-) 1655530-1655544(-) |
| Potential amino acid sequence |
MHLVAKILISLLKYGSSFFALSSDSANAFEDDTSRFSPTEDAVRSNGSSISFVGLGWRLCHASS CQNPDKLVEVWVIILCIIK*(+) MHDTGAILAQQRRCLSHYSELRLLWG*(-) MLEPLLRTASSVGLNLDVSSSKALAESLDNAKNDDPYFNKLIRILATRCMTQAPS*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |