Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0716200_circ_g.5 |
| ID in PlantcircBase | osa_circ_003645 |
| Alias | Os_ciR6074 |
| Organism | Oryza sativa |
| Position | chr1: 29803554-29805114 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os01g0716200 |
| Parent gene annotation |
IQ calmodulin-binding region domain containing protein. (Os01t07 16200-01);Similar to Calmodulin binding protein. (Os01t0716200-0 2);IQ calmodulin-binding region domain containing protein. (Os01 t0716200-03) |
| Parent gene strand | - |
| Alternative splicing | Os01g0716200_circ_g.2 Os01g0716200_circ_g.3 Os01g0716200_circ_g.4 Os01g0716200_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os01t0716200-02:2 Os01t0716200-03:2 Os01t0716200-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.114152098 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
29805081-29804944(+) 29805094-29804966(+) |
| Potential amino acid sequence |
MIPFNARNALRAFRTYAFEDTFSFQASDGLSLRNLCWPDFTTN*(+) MHGMPYVPFEHMRLKIPSLSKRPMVYHSETYVGRTSQQIEWKHRRV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |