Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os01g0716200_circ_g.5 |
ID in PlantcircBase | osa_circ_003645 |
Alias | Os_ciR6074 |
Organism | Oryza sativa |
Position | chr1: 29803554-29805114 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | find_circ |
Parent gene | Os01g0716200 |
Parent gene annotation |
IQ calmodulin-binding region domain containing protein. (Os01t07 16200-01);Similar to Calmodulin binding protein. (Os01t0716200-0 2);IQ calmodulin-binding region domain containing protein. (Os01 t0716200-03) |
Parent gene strand | - |
Alternative splicing | Os01g0716200_circ_g.2 Os01g0716200_circ_g.3 Os01g0716200_circ_g.4 Os01g0716200_circ_g.6 |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os01t0716200-02:2 Os01t0716200-03:2 Os01t0716200-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.114152098 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
29805081-29804944(+) 29805094-29804966(+) |
Potential amino acid sequence |
MIPFNARNALRAFRTYAFEDTFSFQASDGLSLRNLCWPDFTTN*(+) MHGMPYVPFEHMRLKIPSLSKRPMVYHSETYVGRTSQQIEWKHRRV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ye et al., 2015 |