Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os05g0240200_circ_g.2 |
ID in PlantcircBase | osa_circ_027132 |
Alias | NA |
Organism | Oryza sativa |
Position | chr5: 8529004-8530126 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | ue-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os05g0240200 |
Parent gene annotation |
Similar to NB-ARC domain containing protein, expressed. (Os05t02 40200-01);Similar to NB-ARC domain containing protein, expressed . (Os05t0240200-02);Similar to NB-ARC domain containing protein, expressed. (Os05t0240200-03) |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 2 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os05t0240200-02:4 Os05t0240200-03:4 Os05t0240200-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_006087* osi_circ_015196 |
PMCS | 0.152589255 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8530069-8529022(+) 8529414-8529534(-) |
Potential amino acid sequence |
MFAFQASFTNSGVLLTCIYASSTRIL*(+) MNDTANGNPEEAAACSLLSKNDCYLISASGGKVSLFNMLNFKTMTTFIAPPPSATFLAFHPHDN NIIAIGTDDSSILLYNIRVDEAYMHVSRTPELVNEAWKANIVSSGRIRALRMPVTEASSSKVIC LLYRKSGKGLLALSSNAVHKLWKWESNDKNPAGMVRQEN*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |