Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os05g0240200_circ_g.2 |
| ID in PlantcircBase | osa_circ_027132 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr5: 8529004-8530126 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | ue-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os05g0240200 |
| Parent gene annotation |
Similar to NB-ARC domain containing protein, expressed. (Os05t02 40200-01);Similar to NB-ARC domain containing protein, expressed . (Os05t0240200-02);Similar to NB-ARC domain containing protein, expressed. (Os05t0240200-03) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os05t0240200-02:4 Os05t0240200-03:4 Os05t0240200-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_006087* osi_circ_015196 |
| PMCS | 0.152589255 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8530069-8529022(+) 8529414-8529534(-) |
| Potential amino acid sequence |
MFAFQASFTNSGVLLTCIYASSTRIL*(+) MNDTANGNPEEAAACSLLSKNDCYLISASGGKVSLFNMLNFKTMTTFIAPPPSATFLAFHPHDN NIIAIGTDDSSILLYNIRVDEAYMHVSRTPELVNEAWKANIVSSGRIRALRMPVTEASSSKVIC LLYRKSGKGLLALSSNAVHKLWKWESNDKNPAGMVRQEN*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |