Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0754500_circ_g.1 |
ID in PlantcircBase | osa_circ_016608 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 31743521-31746078 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0754500 |
Parent gene annotation |
Tetratricopeptide-like helical domain containing protein. (Os02t 0754500-01) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0754500-01:6 |
Conservation Information | |
---|---|
Conserved circRNAs | osi_circ_004302* |
PMCS | 0.116444638 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
31744243-31743561(+) 31744263-31746015(-) |
Potential amino acid sequence |
MSAFVGIATLSGCCQAVIPLGSHNDHPISLSLLAAHGSDKFLLRNVLYMFSSIKEQVVLASKLV TAPVINRDADFGAAELLKEKGNSAFKGRKWSKAVEFYSDAIKLNGTNATYYSNRAAAYLELGRY KQAEADCEQALLLDKKNVKAYLRRGIAREAVLNHQEALQDMNSRQTTRIGLIL*(+) MPTNALILSSNPGESLCLAFLFKGYPAVVGRTKIPVSFKRFLSAARNSFRTMYKDLMLSLFELT ACSTRVEVSSPSLGFTVLTQSSWFVLNSYLEELLGDSEQLLLRSLVVDML*(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |