Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os10g0566700_circ_g.1 |
| ID in PlantcircBase | osa_circ_008050 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr10: 22454590-22454789 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os10g0566700 |
| Parent gene annotation |
Chaperonin Cpn10 family protein. (Os10t0566700-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os10t0566700-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.304639208 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22454648-22454786(+) 22454762-22454644(+) |
| Potential amino acid sequence |
MGEILSVGADVNEVEAGKKKSVGGVLLPKSAVKFERYLMGEILSVGADVNEVEAGKKKSVGGVL LPKSAVKFERYLMGEILSVGADVNEVEAGKKKSVGGVLLPKSAVKFERYLMGEILSVGADVNEV EAGKK(+) MLMKLKLERRNLLEESCCQNLLLSLRGI*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |