Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0404900_circ_g.7 |
| ID in PlantcircBase | osa_circ_033445 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 12428969-12429197 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os07g0405100 |
| Parent gene annotation |
Similar to F-box-like/WD-repeat protein ebi. (Os07t0405100-01) |
| Parent gene strand | + |
| Alternative splicing | EPlOSAG00000019021_circ_ig.1 Os07g0404900_circ_g.1 Os07g0404900_circ_g.2 Os07g0404900_circ_g.3 Os07g0404900_circ_g.4 Os07g0404900_circ_g.5 Os07g0404900_circ_g.6 Os07g0404900_circ_g.8 |
| Support reads | 1 |
| Tissues | shoot, root, seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0404900-00:1 Os07t0404900-00:1 Os07t0405100-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.400394214 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12428981-12429002(+) 12429005-12429013(-) |
| Potential amino acid sequence |
MDVSTTAHEISSADVTVLEGHSSEVFACAWSPAGSLLASGSHTNGCKHNCS*(+) MSSCAYIHWCGTQTLEGNQLDSMHKRTPLSCVLPKQSHQH*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |