Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0133500_circ_g.1 |
| ID in PlantcircBase | osa_circ_000234 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr1: 1851956-1853965 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os01g0133500 |
| Parent gene annotation |
Beta-lactamase-like domain containing protein. (Os01t0133500-01) ;Similar to predicted protein. (Os01t0133500-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0133500-01:4 Os01t0133500-02:4 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.103592425 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1852016-1851997(+) |
| Potential amino acid sequence |
MSRIGKGNWSIGYTAVAGGENICIGDQQLQVVFAPGHTDGHMGVLHVNTNALIVGDHCVGQGSA TLDNRAGGNMKVSLLFRDATLMLFF*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |