Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0306550_circ_g.4 |
| ID in PlantcircBase | osa_circ_014424 |
| Alias | Os_ciR3738 |
| Organism | Oryza sativa |
| Position | chr2: 12012777-12013344 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | Os02g0306550 |
| Parent gene annotation |
Conserved hypothetical protein. (Os02t0306550-00) |
| Parent gene strand | - |
| Alternative splicing | Os02g0306550_circ_g.1 Os02g0306550_circ_g.2 Os02g0306550_circ_g.3 Os02g0306550_circ_g.5 Os02g0306550_circ_g.6 |
| Support reads | 2 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0306550-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_003846* |
| PMCS | 0.584331214 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12013334-12012779(-) |
| Potential amino acid sequence |
MDESRKMNSNIHNIWSMAKDTDNRVSALHSDVNMVLMDESRQMNSNVRELWSLAKDTERRVEGL HSDMRKIQILMDESRKMNSNIHNIWSMAKDTDNRVSALHSDVNMVLMDESRQMNSNVRELWSLA KDTERRVEGLHSDMRKIQILMDESRKMNSNIHNIWSMAKDTDNRVSALHSDVNMVLMDESRQMN SNVRELWSLAKDTERRVEGLHSDMRKIQILMDESRKMNSNIHNIWSMAKDTDNRVSALHSDVNM VLMDESRQMNSNVRELWSLAKDTERRVEGLHSDMRK(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015 |