Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0578200_circ_g.2 |
| ID in PlantcircBase | osa_circ_034520 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 23391894-23395555 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os07g0578200 |
| Parent gene annotation |
Major facilitator superfamily, general substrate transporter dom ain containing protein. (Os07t0578200-01) |
| Parent gene strand | + |
| Alternative splicing | Os07g0578200_circ_g.3 Os07g0578200_circ_g.4 |
| Support reads | 2 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os07t0578200-01:8 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.118638697 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
23392168-23395547(-) |
| Potential amino acid sequence |
MPQFKMSKAINQFSNEDCCEAICQLTRKHDNSSITVI*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |