Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os01g0332100_circ_g.6 |
| ID in PlantcircBase | osa_circ_001611 |
| Alias | Os01circ10550 |
| Organism | Oryza sativa |
| Position | chr1: 12871778-12872986 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, SMALT, Segemehl |
| Parent gene | Os01g0332100 |
| Parent gene annotation |
Similar to Neutral invertase-like protein (Fragment). (Os01t0332 100-01);Similar to Invertase. (Os01t0332100-02) |
| Parent gene strand | + |
| Alternative splicing | Os01g0332100_circ_g.3 Os01g0332100_circ_g.4 Os01g0332100_circ_g.5 Os01g0332100_circ_g.7 |
| Support reads | 2/1 |
| Tissues | leaf and panicle/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os01t0332150-00:3 Os01t0332150-00:3 Os01t0332100-01:3 Os01t0332100-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.48051688 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
12871824-12871820(+) 12872945-12871794(+) |
| Potential amino acid sequence |
MPASFKIRAVPLDDNNEAFEEVLDPDFGESAIGRVAPVDSGLWWIILLRAYCKITGDNALQERV DVQTGIKLILSLCLSDGFDMFPTLLVTDGSCMIDRRMGIHGHPLEIQALFYSALRCSREMLVMN DGSKNLLRAINNRLSALSFHIREYYWVDMKKINEIYRYKTEEYSHDATNKFNIYPEQIPSWLVD WIPEKGGYLIGNLQPAHMDFRFFSLGNLWAITSSLTTPKQAEGILSLIDEKWDDLIANMPLKIC YPAMEDDEWRIITGSDPKNTAGRRLLIVTALGKA*(+) MMNGALLPAVILRTQLGEDC*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015;Chu et al., 2017 |