Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_03G121500_circ_g.3 |
| ID in PlantcircBase | gma_circ_005645 |
| Alias | gma-circRNA0323 |
| Organism | Glycine max |
| Position | chr3: 33390754-33391348 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | find_circ |
| Parent gene | GLYMA_03G121500 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_03G121300_circ_ag.1 GLYMA_03G121500_circ_g.1 GLYMA_03G121500_circ_g.2 |
| Support reads | NA |
| Tissues | flower bud |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH66676:2 KRH66675:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.256967787 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
33391287-33390756(-) |
| Potential amino acid sequence |
MEEIGPTLAKAHDFIKKTQVKDDPLGDFKSMYRHISKGSWTFSDQDQGWQVSDCTAETLNSFGS QGWDASLVIQALLATNLMEEIGPTLAKAHDFIKKTQVKDDPLGDFKSMYRHISKGSWTFSDQDQ GWQVSDCTAETLNSFGSQGWDASLVIQALLATNLMEEIGPTLAKAHDFIKKTQVKDDPLGDFKS MYRHISKGSWTFSDQDQGWQVSDCTAETLNSFGSQGWDASLVIQALLATNLMEEIGPTLAKAHD FIKKTQVKDDPLGDFKSMYRHISKGSWTFSDQDQGWQVSDCTAETLN(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chen et al., 2018 |