Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0540800_circ_g.2 |
ID in PlantcircBase | osa_circ_011899 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 21621803-21622123 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os12g0540800 |
Parent gene annotation |
Galactose oxidase/kelch, beta-propeller domain containing protei n. (Os12t0540800-01);Hypothetical conserved gene. (Os12t0540800- 02) |
Parent gene strand | + |
Alternative splicing | Os12g0540800_circ_g.1 Os12g0540800_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os12t0540800-01:2 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.315257139 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
21621922-21621864(+) 21622065-21621850(+) |
Potential amino acid sequence |
MQTMEWSRPEHQGITPEPRAGHAGVTVGENWFITGGGNNKKEAHPLLQGQSMLLRAMLIVIS*( +) MQVLRLVRTGLLLEVVITRKRHTPFSKVRACCCVLC*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |