Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.005G073300_circ_g.1 |
| ID in PlantcircBase | gra_circ_000457 |
| Alias | Chr05:8034047|8034603 |
| Organism | Gossypium raimondii |
| Position | chrChr05: 8034047-8034603 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.005G073300 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2/2 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.005G073300.2:3 Gorai.005G073300.4:3 Gorai.005G073300.1:3 Gorai.005G073300.3:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.178655072 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8034080-8034098(+) 8034552-8034105(+) 8034136-8034602(-) |
| Potential amino acid sequence |
MFCTRTLNLRSISAIGYDMDYTLIHYNVMAWEGRAYDYCMENLKSMGFPVEGLAFDPDLVIRGL VIDKEKGNLVKADRFGYVKRAMHGTKMLSTRAVRVLQQQGSLLVVCFAPGR*(+) MLKGPCMALKCYLLELLESFSSKALSSWYVLHPDAES*(+) MSYPIALIDLRFSVRVQNIPRGESLAAEGL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |