Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os08g0519800_circ_g.6 |
| ID in PlantcircBase | osa_circ_037719 |
| Alias | Os08circ13924 |
| Organism | Oryza sativa |
| Position | chr8: 25841657-25841764 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | SMALT, Segemehl |
| Parent gene | Os08g0519800 |
| Parent gene annotation |
Similar to Maternal pumilio protein. Splice isoform E. (Os08t051 9800-01);Pumilio RNA-binding repeat domain containing protein. ( Os08t0519800-02) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 2 |
| Tissues | leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os08t0519800-01:1 Os08t0519800-02:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.453125309 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
25841739-25841761(+) 25841718-25841722(-) |
| Potential amino acid sequence |
MYGCRVIQKFFEHGTPEQRRDLATKLVGHVLPLSLQMYGCRVIQKFFEHGTPEQRRDLATKLVG HVLPLSLQMYGCRVIQKFFEHGTPEQRRDLATKLVGHVLPLSLQMYGCRVIQK(+) MTNKLSGKIPPLFRSSMFEELLNYSASIHLKAQR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Lu et al., 2015 |