Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0728600_circ_g.2 |
| ID in PlantcircBase | osa_circ_016392 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 30324531-30325364 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0728600 |
| Parent gene annotation |
Similar to H/ACA ribonucleoprotein complex subunit 2. (Os02t0728 600-01) |
| Parent gene strand | - |
| Alternative splicing | Os02g0728600_circ_g.1 |
| Support reads | 4 |
| Tissues | root, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os02t0728600-01:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.157015558 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
30324589-30324552(+) 30325314-30324562(+) 30324591-30324573(-) |
| Potential amino acid sequence |
MCNHIDRRNIPSNYTQPFVPTTDALDHLLDSPLQALGLRCSFDGTYM*(+) MLLTTSLTPRFRHLASDALLMAHICKEY*(+) MFQYFVRKLIFLTYMCHQKSIGGQVPEAGSQGGGQEHPSWEQRVVCNCWEYFSYRCDYTCSNTL *(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |