Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | GLYMA_08G343800_circ_g.1 |
| ID in PlantcircBase | gma_circ_002222 |
| Alias | Gm08circRNA1007 |
| Organism | Glycine max |
| Position | chr8: 45895003-45896039 JBrowse» |
| Reference genome | v2.0.38 |
| Type | e-circRNA |
| Identification method | Tophat |
| Parent gene | GLYMA_08G343800 |
| Parent gene annotation |
hypothetical protein |
| Parent gene strand | - |
| Alternative splicing | GLYMA_08G343800_circ_g.2 |
| Support reads | NA |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | KRH46580:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ath_circ_033900* |
| PMCS | 0.031983221 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
45895228-45895237(+) 45895056-45895211(-) |
| Potential amino acid sequence |
MTSCEILLSQNARSFRSSSISSFFWHPVVGFAMLNPVKQKSNTTRSQHSLLHWKSLFVTTSGNF EDIALKFLTECISDDLL*(+) MKQGVLTPGRVRLLLHRVQHRESHHWMPEEARDRRRSETASILGQEDLTGGHRRCTR*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017a |