Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os02g0815000_circ_g.1 |
| ID in PlantcircBase | osa_circ_017135 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr2: 34919301-34919402 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, PcircRNA_finder |
| Parent gene | Os02g0815000 |
| Parent gene annotation |
Similar to 60S ribosomal protein L37 (G1.16). (Os02t0815000-00) |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 1 |
| Tissues | shoot, pistil |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Os02t0815000-00:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.449347222 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
34919352-34919399(+) 34919324-34919303(-) |
| Potential amino acid sequence |
MRYLRHVPKRFKSNFREDNWSVKAIRRKTTGTGRMRYLRHVPKRFKSNFREDNWSVKAIRRKTT GTGRMRYLRHVPKRFKSNFREDNWSVKAIRRKTTGTGRMRYLRHVPKRFKSNFRE(+) MAFTLQLSSLKLLLNLLGTWRRYLILPVPVVFLLMAFTLQLSSLKLLLNLLGTWRRYLILPVPV VFLLMAFTLQLSSLKLLLNLLGTWRRYLILPVPVVFLLMAFTLQL(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |