Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0815000_circ_g.1 |
ID in PlantcircBase | osa_circ_017135 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 34919301-34919402 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, PcircRNA_finder |
Parent gene | Os02g0815000 |
Parent gene annotation |
Similar to 60S ribosomal protein L37 (G1.16). (Os02t0815000-00) |
Parent gene strand | + |
Alternative splicing | NA |
Support reads | 1 |
Tissues | shoot, pistil |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0815000-00:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.449347222 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
34919352-34919399(+) 34919324-34919303(-) |
Potential amino acid sequence |
MRYLRHVPKRFKSNFREDNWSVKAIRRKTTGTGRMRYLRHVPKRFKSNFREDNWSVKAIRRKTT GTGRMRYLRHVPKRFKSNFREDNWSVKAIRRKTTGTGRMRYLRHVPKRFKSNFRE(+) MAFTLQLSSLKLLLNLLGTWRRYLILPVPVVFLLMAFTLQLSSLKLLLNLLGTWRRYLILPVPV VFLLMAFTLQLSSLKLLLNLLGTWRRYLILPVPVVFLLMAFTLQL(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |