Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | orai.012G051400_circ_g.1 |
| ID in PlantcircBase | gra_circ_001310 |
| Alias | Chr12:6657491|6657917 |
| Organism | Gossypium raimondii |
| Position | chrChr12: 6657491-6657917 JBrowse» |
| Reference genome | Graimondii_221 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | Gorai.012G051400 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | NA |
| Support reads | 4/4 |
| Tissues | leaf/ovule |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | Gorai.012G051400.1:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | ghi_circ_000273* gar_circ_000362 |
| PMCS | 0.637196097 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
6657585-6657496(+) 6657587-6657803(-) |
| Potential amino acid sequence |
MDPKGFVDMLLIFLEDRGDGPLVHPSLGNIIDGEDRILPFLGKWEGHSVTKRSGVYGSTMTEAD TVSYLEMDDKKKLIQKC*(+) MIWKALARRSFACEYRQFSQTIEGWREGSLTFLDELFLVVHFKIRNCISFGHRRSINTTAFCYR MTFPLA*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Zhao et al., 2017b |