Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT2G39090_circ_g.3 |
ID in PlantcircBase | ath_circ_017334 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr2: 16314483-16315378 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | PcircRNA_finder |
Parent gene | AT2G39090 |
Parent gene annotation |
AtAPC7 |
Parent gene strand | - |
Alternative splicing | AT2G39090_circ_g.1 AT2G39090_circ_g.2 AT2G39090_circ_g.4 AT2G39090_circ_g.5 |
Support reads | 1 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT2G39090.1:4 AT2G39090.2:4 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.12421023 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
16314498-16314485(-) |
Potential amino acid sequence |
MRFEKTSNRSAKVSLDQIDPTRWLQRYVEAQCCVASHAYKGALELFAELLQRFPNNVHLLTETA KVEAIIGKNDEAIMRFEKTSNRSAKVSLDQIDPTRWLQRYVEAQCCVASHAYKGALELFAELLQ RFPNNVHLLTETAKVEAIIGKNDEAIMRFEKTSNRSAKVSLDQIDPTRWLQRYVEAQCCVASHA YKGALELFAELLQRFPNNVHLLTETAKVEAIIGKNDEAIMRFEK(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |