Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | LOC18034302_circ_g.1 |
| ID in PlantcircBase | ptr_circ_000460 |
| Alias | circRNA462 |
| Organism | Poncirus trifoliata |
| Position | chrNW_006262022.1: 1825993-1827080 JBrowse» |
| Reference genome | Citrus_clementina_v1.0 |
| Type | e-circRNA |
| Identification method | CIRI |
| Parent gene | LOC18034302 |
| Parent gene annotation | NA |
| Parent gene strand | + |
| Alternative splicing | LOC18034302_circ_g.2 LOC18034302_circ_ag.1 LOC18034302_circ_ag.2 LOC18034302_circ_ag.3 LOC18034302_circ_ag.4 LOC18034302_circ_ag.5 |
| Support reads | NA |
| Tissues | shoots |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | XM_006422707.2:5 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
1826259-1826046(+) 1826005-1827017(-) |
| Potential amino acid sequence |
MNDTLSAVQTYFFLRKWLIAHPSFLANPLYIFGESYSGKVLPIVVQKISDGIDLGDEPRMNLKG YVLGNPVTDEASDMNFRPQFAYMKGLITHEIYEVHCHLTTKILEKIPQSCC*(+) MTMDLVDFMGDESLHICELWSKIHV*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | playing an important role in the early flowering process |
| Other Information | |
|---|---|
| References | Zeng et al., 2018 |