Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Zm00001d045154_circ_g.1 |
ID in PlantcircBase | zma_circ_009853 |
Alias | zma_circ_0003097 |
Organism | Zea mays |
Position | chr9: 14552445-14553593 JBrowse» |
Reference genome | AGPv4.38 |
Type | ue-circRNA |
Identification method | find_circ |
Parent gene | Zm00001d045154 |
Parent gene annotation |
Putative clathrin assembly protein |
Parent gene strand | + |
Alternative splicing | Zm00001d045154_circ_g.2 Zm00001d045154_circ_g.3 |
Support reads | NA |
Tissues | leaf, root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Zm00001d045154_T004:4 Zm00001d045154_T002:5 Zm00001d045154_T001:5 Zm00001d045154_T003:5 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.170623971 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
14552483-14552450(+) |
Potential amino acid sequence |
MAVGGTQPVLRKYLGALKDTTTVSLAKVNSDYKELDIAIVKATNHVERPSKEKYIREIFHSISA ARPRADVAYCIHALARRLSKTRNWAVALKTLIVIHRALREVDPTFREELLNYGRSRSHMLNMAY FKDDSSAEAWDYSAWVRIYALYLEERLECFRVLKYDVETDPPAN*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Ma et al., 2021b |