Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G16280_circ_g.1 |
| ID in PlantcircBase | ath_circ_002883 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr1: 5569180-5569383 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
| Parent gene | AT1G16280 |
| Parent gene annotation |
DEAD-box ATP-dependent RNA helicase 36 |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3 |
| Tissues | whole_plant |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G16280.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.440146833 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
5569362-5569182(-) |
| Potential amino acid sequence |
MLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVDLVINYDIPRTCQ RLSLMLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVDLVINYDIP RTCQRLSLMLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVDLVIN YDIPRTCQRLSLMLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVD LVINYDIP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |