Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G16280_circ_g.1 |
ID in PlantcircBase | ath_circ_002883 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr1: 5569180-5569383 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | KNIFE, PcircRNA_finder, circRNA_finder, find_circ |
Parent gene | AT1G16280 |
Parent gene annotation |
DEAD-box ATP-dependent RNA helicase 36 |
Parent gene strand | - |
Alternative splicing | NA |
Support reads | 3 |
Tissues | whole_plant |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G16280.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.440146833 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
5569362-5569182(-) |
Potential amino acid sequence |
MLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVDLVINYDIPRTCQ RLSLMLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVDLVINYDIP RTCQRLSLMLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVDLVIN YDIPRTCQRLSLMLDELEVENIAMHSLNSQSMRLSALSKFKSGKVPILLATDVASRGLDIPTVD LVINYDIP(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |