Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os07g0632800_circ_g.4 |
| ID in PlantcircBase | osa_circ_034904 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr7: 26246476-26249493 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | Os07g0632800 |
| Parent gene annotation |
Similar to predicted protein. (Os07t0632800-01) |
| Parent gene strand | - |
| Alternative splicing | Os07g0632800_circ_g.1 Os07g0632800_circ_g.2 Os07g0632800_circ_g.3 Os07g0632800_circ_g.5 Os07g0632800_circ_g.6 Os07g0632800_circ_g.7 Os07g0632800_circ_g.8 Os07g0632800_circ_g.9 Os07g0632800_circ_g.10 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os07t0632800-01:7 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.115699351 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
26249462-26246526(+) 26249459-26249485(-) |
| Potential amino acid sequence |
MPLCTLRISKWSFQSPQSSCTHHWHAGL*(+) MIELLKEHGGLTYGKTGSHFEPKTIPPPLTNKADWEINPLELDFSKAVIIGKGSFGEILKANWR GTPIAVKRILPSLSDDRLVIQDFKHEVNLLIKLRHPNIVQFLGAVTETKPLMLVTEFLRGGDLH QYLKEKGALAPATAVNFALDIARGMAYLHNEPNVVIHRDLKPRNILLVNSAANHLKVGDFGLSK IIKAQHANDVYKMTGETGSSTC*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |