Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT4G15230_circ_g.1 |
ID in PlantcircBase | ath_circ_031045 |
Alias | NA |
Organism | Arabidpsis thaliana |
Position | chr4: 8683148-8683308 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | AT4G15230 |
Parent gene annotation |
ABC transporter G family member 30 |
Parent gene strand | + |
Alternative splicing | 4_circ_ag.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 4_circ_ag.8 4_circ_ag.9 AT4G15230_circ_g.2 AT4G15230_circ_g.3 |
Support reads | 1 |
Tissues | root |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | AT4G15230.2:1 AT4G15230.3:1 AT4G15230.4:1 AT4G15230.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.187892032 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
8683200-8683305(+) |
Potential amino acid sequence |
MFRAIAAIFRTIIASTITGAISILVLSLFGGFVIPKCSSCSSLSYLHSTFLVYQCFALLRQSFA QLLLPQSLELFPYWFSHYLVASLFQNVLPAVPYLIYIQPFLCINVSRYCGNLSHNYCFHNHWSY FHIGSLIIWWLRYSKMFFLQFLILSTFNLSCVSMFRAIAAIFRTIIASTITGAISILVLSLFGG FVIPK(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |