Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT4G15230_circ_g.1 |
| ID in PlantcircBase | ath_circ_031045 |
| Alias | NA |
| Organism | Arabidpsis thaliana |
| Position | chr4: 8683148-8683308 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer |
| Parent gene | AT4G15230 |
| Parent gene annotation |
ABC transporter G family member 30 |
| Parent gene strand | + |
| Alternative splicing | 4_circ_ag.2 4_circ_ag.3 4_circ_ag.4 4_circ_ag.5 4_circ_ag.6 4_circ_ag.7 4_circ_ag.8 4_circ_ag.9 AT4G15230_circ_g.2 AT4G15230_circ_g.3 |
| Support reads | 1 |
| Tissues | root |
| Exon boundary | Yes-Yes |
| Splicing signals | GT-AG |
| Number of exons covered | AT4G15230.2:1 AT4G15230.3:1 AT4G15230.4:1 AT4G15230.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.187892032 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
8683200-8683305(+) |
| Potential amino acid sequence |
MFRAIAAIFRTIIASTITGAISILVLSLFGGFVIPKCSSCSSLSYLHSTFLVYQCFALLRQSFA QLLLPQSLELFPYWFSHYLVASLFQNVLPAVPYLIYIQPFLCINVSRYCGNLSHNYCFHNHWSY FHIGSLIIWWLRYSKMFFLQFLILSTFNLSCVSMFRAIAAIFRTIIASTITGAISILVLSLFGG FVIPK(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |