Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | AT1G60590_circ_g.4 |
ID in PlantcircBase | ath_circ_008159 |
Alias | AT1G60590_C1 |
Organism | Arabidpsis thaliana |
Position | chr1: 22315622-22315852 JBrowse» |
Reference genome | TAIR10.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
Parent gene | AT1G60590 |
Parent gene annotation |
Pectin lyase-like superfamily protein |
Parent gene strand | - |
Alternative splicing | AT1G60590_circ_g.1 AT1G60590_circ_g.2 AT1G60590_circ_g.3 |
Support reads | 3/2 |
Tissues | whole_plant/seedlings, leaf |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | AT1G60590.1:1 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.519539562 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
22315844-22315624(-) |
Potential amino acid sequence |
MIVAPTDTESWGGGLMWWIEFTKLSGITIQGNGVIDGRGTVWWQQDYLSDYPIDDDFKLIVPLN NSVQERPPMPLEGMIVAPTDTESWGGGLMWWIEFTKLSGITIQGNGVIDGRGTVWWQQDYLSDY PIDDDFKLIVPLNNSVQERPPMPLEGMIVAPTDTESWGGGLMWWIEFTKLSGITIQGNGVIDGR GTVWWQQDYLSDYPIDDDFKLIVPLNNSVQERPPMPLEGMIVAPTDTESWGGGLMWWIEFTKLS GITIQGNGVIDGRGTVWWQQDYLSDYPIDDDFKLIVPLNNSVQERPPMP(-) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | response to drought stress |
Other Information | |
---|---|
References | Chu et al., 2017;Pan et al., 2017;Zhang et al., 2019 |