Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | AT1G60590_circ_g.4 |
| ID in PlantcircBase | ath_circ_008159 |
| Alias | AT1G60590_C1 |
| Organism | Arabidpsis thaliana |
| Position | chr1: 22315622-22315852 JBrowse» |
| Reference genome | TAIR10.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder, circRNA_finder, find_circ, CIRI2 |
| Parent gene | AT1G60590 |
| Parent gene annotation |
Pectin lyase-like superfamily protein |
| Parent gene strand | - |
| Alternative splicing | AT1G60590_circ_g.1 AT1G60590_circ_g.2 AT1G60590_circ_g.3 |
| Support reads | 3/2 |
| Tissues | whole_plant/seedlings, leaf |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | AT1G60590.1:1 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.519539562 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
22315844-22315624(-) |
| Potential amino acid sequence |
MIVAPTDTESWGGGLMWWIEFTKLSGITIQGNGVIDGRGTVWWQQDYLSDYPIDDDFKLIVPLN NSVQERPPMPLEGMIVAPTDTESWGGGLMWWIEFTKLSGITIQGNGVIDGRGTVWWQQDYLSDY PIDDDFKLIVPLNNSVQERPPMPLEGMIVAPTDTESWGGGLMWWIEFTKLSGITIQGNGVIDGR GTVWWQQDYLSDYPIDDDFKLIVPLNNSVQERPPMPLEGMIVAPTDTESWGGGLMWWIEFTKLS GITIQGNGVIDGRGTVWWQQDYLSDYPIDDDFKLIVPLNNSVQERPPMP(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | response to drought stress |
| Other Information | |
|---|---|
| References | Chu et al., 2017;Pan et al., 2017;Zhang et al., 2019 |