Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os02g0105200_circ_g.2 |
ID in PlantcircBase | osa_circ_012657 |
Alias | NA |
Organism | Oryza sativa |
Position | chr2: 288808-291938 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer |
Parent gene | Os02g0105200 |
Parent gene annotation |
Similar to Dihydrolipoamide S-acetyltransferase (EC 2.3.1.12). ( Os02t0105200-01) |
Parent gene strand | + |
Alternative splicing | Os02g0105200_circ_g.1 Os02g0105200_circ_g.3 Os02g0105200_circ_g.4 Os02g0105200_circ_g.5 |
Support reads | 1 |
Tissues | shoot |
Exon boundary | Yes-Yes |
Splicing signals | GT-AG |
Number of exons covered | Os02t0105200-01:10 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.122979019 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
290004-288811(+) |
Potential amino acid sequence |
MPSLSPTMTEGNIARWLKKEGDKVSPGEVLCEVETDKATVEMECMEEGYLAKIIHGDGAKEIKV GEIIAVTVEEEGDLEKFKDYKPSTSAAPAAPSEPKAQPEPAEPKVKETEPSRTPEPKAPKTEEA SQPGGRIFSSPLARKLAEDNNVPLSSVMGTGPDGRILKADIEDYLASVAKGGKREALAAPGLSY TDVPNTQIRKVTANRLLSSKQTIPHYYLTVDARVDNLIKC*(+) |
Sponge-miRNAs | osa-miR2919 |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |