Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os06g0144850_circ_g.1 |
| ID in PlantcircBase | osa_circ_029665 |
| Alias | Os_ciR5517 |
| Organism | Oryza sativa |
| Position | chr6: 2369183-2369801 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, find_circ |
| Parent gene | Os06g0144800 |
| Parent gene annotation |
Similar to GTP-binding protein lepA. (Os06t0144800-01) |
| Parent gene strand | - |
| Alternative splicing | NA |
| Support reads | 3/4 |
| Tissues | root/shoot, root |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os06t0144850-00:2 Os06t0144800-01:4 Os06t0144850-00:2 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | osi_circ_016417 |
| PMCS | 0.407932189 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2369434-2369606(-) 2369212-2369751(-) |
| Potential amino acid sequence |
MLCSERRGEQQEYTFIDAQRALLKYRLPLREIIVDFYNELKSITSGYATFDYEDSENMELKSYR QYRQCHISLSMVMEAKCKSRTLQLWLQILESV*(-) MLLLIMKILRTWSSSHIDNTDSAIYL*(-) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Ye et al., 2015;Chu et al., 2017 |