Detailed infomation of each circRNA
General Information | |
---|---|
CircRNA Name | Os12g0143950_circ_g.2 |
ID in PlantcircBase | osa_circ_010461 |
Alias | NA |
Organism | Oryza sativa |
Position | chr12: 2162595-2163658 JBrowse» |
Reference genome | IRGSP-1.0.38 |
Type | e-circRNA |
Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
Parent gene | Os12g0143900 |
Parent gene annotation |
Similar to Long chain acyl-CoA synthetase 6 (EC 6.2.1.3). (Os12t 0143900-01) |
Parent gene strand | - |
Alternative splicing | Os12g0143950_circ_g.1 Os12g0143950_circ_g.3 Os12g0143950_circ_g.4 |
Support reads | 1 |
Tissues | seed |
Exon boundary | Yes-Yes |
Splicing signals | CT-AC |
Number of exons covered | Os12t0143950-00:3 Os12t0143950-00:3 Os12t0143900-01:3 |
Conservation Information | |
---|---|
Conserved circRNAs | NA |
PMCS | 0.156087249 |
Functional Information | |
---|---|
Coding potential | Y |
Potential coding position |
2162852-2162669(+) |
Potential amino acid sequence |
MFFFLSIIFRRPPGIHKPMSPVCNQPSSSTASLLDSLRCSPSLQHIWFNCYYGNQRRV*(+) |
Sponge-miRNAs | NA |
circRNA-miRNA-mRNA network | VISUALIZATION |
Potential function description | NA |
Other Information | |
---|---|
References | Chu et al., 2017 |