Detailed infomation of each circRNA
| General Information | |
|---|---|
| CircRNA Name | Os12g0143950_circ_g.2 |
| ID in PlantcircBase | osa_circ_010461 |
| Alias | NA |
| Organism | Oryza sativa |
| Position | chr12: 2162595-2163658 JBrowse» |
| Reference genome | IRGSP-1.0.38 |
| Type | e-circRNA |
| Identification method | CIRCexplorer, KNIFE, PcircRNA_finder |
| Parent gene | Os12g0143900 |
| Parent gene annotation |
Similar to Long chain acyl-CoA synthetase 6 (EC 6.2.1.3). (Os12t 0143900-01) |
| Parent gene strand | - |
| Alternative splicing | Os12g0143950_circ_g.1 Os12g0143950_circ_g.3 Os12g0143950_circ_g.4 |
| Support reads | 1 |
| Tissues | seed |
| Exon boundary | Yes-Yes |
| Splicing signals | CT-AC |
| Number of exons covered | Os12t0143950-00:3 Os12t0143950-00:3 Os12t0143900-01:3 |
| Conservation Information | |
|---|---|
| Conserved circRNAs | NA |
| PMCS | 0.156087249 |
| Functional Information | |
|---|---|
| Coding potential | Y |
| Potential coding position |
2162852-2162669(+) |
| Potential amino acid sequence |
MFFFLSIIFRRPPGIHKPMSPVCNQPSSSTASLLDSLRCSPSLQHIWFNCYYGNQRRV*(+) |
| Sponge-miRNAs | NA |
| circRNA-miRNA-mRNA network | VISUALIZATION |
| Potential function description | NA |
| Other Information | |
|---|---|
| References | Chu et al., 2017 |